SCOPe 2.08: Domain d2dqfe_: 2dqf E:

Lineage for d2dqfe_ (2dqf E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (32 PDB entries)

8. Domain d2dqfe_: 2dqf E: [145084]
   Other proteins in same PDB: d2dqfa_, d2dqfc_, d2dqfd_, d2dqff_
   automated match to d2dqfb1
   mutant

Details for d2dqfe_

PDB Entry: 2dqf, 2.5 Å

PDB Description: Crystal structure of hyhel-10 FV mutant (y33ay53a) complexed with hen egg lysozyme

PDB Compounds: (E:) Ig VH,anti-lysozyme

SCOPe Domain Sequences for d2dqfe_:

Sequence; same for both SEQRES and ATOM records:

>d2dqfe_ b.1.1.1 (E:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdawswirkfpgnrleymgyvsasgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

Timeline for d2dqfe_:

• d2dqfe_ first appeared in SCOP 1.75, called d2dqfe1
  
• d2dqfe_ appears in SCOPe 2.07