Lineage for d2dqch1 (2dqc H:1-114)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782566Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (28 PDB entries)
  8. 782572Domain d2dqch1: 2dqc H:1-114 [145080]
    Other proteins in same PDB: d2dqcl1, d2dqcy1
    mutant

Details for d2dqch1

PDB Entry: 2dqc (more details), 1.8 Å

PDB Description: Crystal structure of hyhel-10 FV mutant(Hy33f) complexed with hen egg lysozyme
PDB Compounds: (H:) Ig VH,anti-lysozyme

SCOP Domain Sequences for d2dqch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dqch1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
dvqlqesgpslvkpsqtlsltcsvtgdsitsdfwswirkfpgnrleymgyvsysgstyyn
pslksrisitrdtsknqyyldlnsvttedtatyycanwdgdywgqgtlvtvsaa

SCOP Domain Coordinates for d2dqch1:

Click to download the PDB-style file with coordinates for d2dqch1.
(The format of our PDB-style files is described here.)

Timeline for d2dqch1: