SCOPe 2.07: Domain d2dd8l2: 2dd8 L:109-213

Lineage for d2dd8l2 (2dd8 L:109-213)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88572] (47 PDB entries)

8. Domain d2dd8l2: 2dd8 L:109-213 [145076]
   Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8h3, d2dd8l1, d2dd8s1
   complexed with nag, po4

Details for d2dd8l2

PDB Entry: 2dd8, 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody

PDB Compounds: (L:) IGG Light chain

SCOPe Domain Sequences for d2dd8l2:

Sequence; same for both SEQRES and ATOM records:

>d2dd8l2 b.1.1.2 (L:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

Timeline for d2dd8l2:

• d2dd8l2 first appeared in SCOP 1.75
  
• d2dd8l2 appears in SCOPe 2.06
  
• d2dd8l2 appears in the current release, SCOPe 2.08