Lineage for d2dd8l2 (2dd8 L:109-213)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109002Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1109006Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1109028Domain d2dd8l2: 2dd8 L:109-213 [145076]
    Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8l1, d2dd8s1
    complexed with nag, po4

Details for d2dd8l2

PDB Entry: 2dd8 (more details), 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
PDB Compounds: (L:) IGG Light chain

SCOPe Domain Sequences for d2dd8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd8l2 b.1.1.2 (L:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec

SCOPe Domain Coordinates for d2dd8l2:

Click to download the PDB-style file with coordinates for d2dd8l2.
(The format of our PDB-style files is described here.)

Timeline for d2dd8l2: