![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
![]() | Domain d2dd8l2: 2dd8 L:109-213 [145076] Other proteins in same PDB: d2dd8h1, d2dd8h2, d2dd8l1, d2dd8s1 complexed with nag, po4 |
PDB Entry: 2dd8 (more details), 2.3 Å
SCOPe Domain Sequences for d2dd8l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dd8l2 b.1.1.2 (L:109-213) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq snnkyaassylsltpeqwkshrsyscqvthegstvektvaptec
Timeline for d2dd8l2: