Lineage for d2dd8h2 (2dd8 H:114-216)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107361Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1107365Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1107447Domain d2dd8h2: 2dd8 H:114-216 [145074]
    Other proteins in same PDB: d2dd8h1, d2dd8l1, d2dd8l2, d2dd8s1
    complexed with nag, po4

Details for d2dd8h2

PDB Entry: 2dd8 (more details), 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
PDB Compounds: (H:) IGG Heavy chain

SCOPe Domain Sequences for d2dd8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd8h2 b.1.1.2 (H:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOPe Domain Coordinates for d2dd8h2:

Click to download the PDB-style file with coordinates for d2dd8h2.
(The format of our PDB-style files is described here.)

Timeline for d2dd8h2: