SCOPe 2.07: Domain d2dd8h1: 2dd8 H:9-113

Lineage for d2dd8h1 (2dd8 H:9-113)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)

8. Domain d2dd8h1: 2dd8 H:9-113 [145073]
   Other proteins in same PDB: d2dd8h2, d2dd8h3, d2dd8l1, d2dd8l2, d2dd8s1
   complexed with nag, po4

Details for d2dd8h1

PDB Entry: 2dd8, 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody

PDB Compounds: (H:) IGG Heavy chain

SCOPe Domain Sequences for d2dd8h1:

Sequence; same for both SEQRES and ATOM records:

>d2dd8h1 b.1.1.1 (H:9-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
aevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianyaqkfqgrv
tittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvss

Timeline for d2dd8h1:

• d2dd8h1 first appeared in SCOP 1.75
  
• d2dd8h1 appears in SCOPe 2.06
  
• d2dd8h1 appears in the current release, SCOPe 2.08