Lineage for d2dd8h1 (2dd8 H:2-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 781850Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (36 PDB entries)
  8. 781881Domain d2dd8h1: 2dd8 H:2-113 [145073]
    Other proteins in same PDB: d2dd8h2, d2dd8l1, d2dd8l2, d2dd8s1
    complexed with nag, po4

Details for d2dd8h1

PDB Entry: 2dd8 (more details), 2.3 Å

PDB Description: crystal structure of sars-cov spike receptor-binding domain complexed with neutralizing antibody
PDB Compounds: (H:) IGG Heavy chain

SCOP Domain Sequences for d2dd8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dd8h1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianya
qkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvss

SCOP Domain Coordinates for d2dd8h1:

Click to download the PDB-style file with coordinates for d2dd8h1.
(The format of our PDB-style files is described here.)

Timeline for d2dd8h1: