Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.1: CBS-domain pair [54632] (21 proteins) Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain |
Protein Chloride channel protein, CBS tandem [143138] (1 species) contains additional structures between the two CBS repeats |
Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [143139] (1 PDB entry) Uniprot P21564 527-606! Uniprot P21564 691-770 |
Domain d2d4zb3: 2d4z B:527-606,B:691-770 [145072] |
PDB Entry: 2d4z (more details), 3.1 Å
SCOPe Domain Sequences for d2d4zb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d4zb3 d.37.1.1 (B:527-606,B:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} lswssankyniqvgdimvrdvtsiaststygdllhvlrqtklkffpfvdtpdtntllgsi drtevegllqrrisayrrqpXfeemltleeiyrweqreknvvvnfetcridqspfqlveg tslqkthtlfsllgldrayvtsmgklvgvvalaeiqaaieg
Timeline for d2d4zb3: