SCOPe 2.06: Domain d2d4zb3: 2d4z B:527-606,B:691-770

Lineage for d2d4zb3 (2d4z B:527-606,B:691-770)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein Chloride channel protein, CBS tandem [143138] (1 species)
   contains additional structures between the two CBS repeats

7. Species Marbled electric ray (Torpedo marmorata) [TaxId:7788] [143139] (1 PDB entry)
   Uniprot P21564 527-606! Uniprot P21564 691-770

8. Domain d2d4zb3: 2d4z B:527-606,B:691-770 [145072]

Details for d2d4zb3

PDB Entry: 2d4z, 3.1 Å

PDB Description: Crystal structure of the cytoplasmic domain of the chloride channel ClC-0

PDB Compounds: (B:) Chloride channel protein

SCOPe Domain Sequences for d2d4zb3:

Sequence; same for both SEQRES and ATOM records:

>d2d4zb3 d.37.1.1 (B:527-606,B:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]}
lswssankyniqvgdimvrdvtsiaststygdllhvlrqtklkffpfvdtpdtntllgsi
drtevegllqrrisayrrqpXfeemltleeiyrweqreknvvvnfetcridqspfqlveg
tslqkthtlfsllgldrayvtsmgklvgvvalaeiqaaieg

Timeline for d2d4zb3:

• d2d4zb3 first appeared in SCOP 1.75
  
• d2d4zb3 appears in SCOPe 2.05
  
• d2d4zb3 appears in SCOPe 2.07
  
• d2d4zb3 appears in the current release, SCOPe 2.08