Lineage for d2d31a1 (2d31 A:182-274)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1106699Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1106700Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 1106911Domain d2d31a1: 2d31 A:182-274 [145067]
    Other proteins in same PDB: d2d31a2, d2d31b1, d2d31d2, d2d31e1

Details for d2d31a1

PDB Entry: 2d31 (more details), 3.2 Å

PDB Description: crystal structure of disulfide-linked hla-g dimer
PDB Compounds: (A:) HLA class I histocompatibility antigen, alpha chain G

SCOPe Domain Sequences for d2d31a1:

Sequence, based on SEQRES records: (download)

>d2d31a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvfdyeatlrcwalgfypaeiiltwqrdgedqtqdvelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpeplmlrw

Sequence, based on observed residues (ATOM records): (download)

>d2d31a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvfatlrcwalgfypaeiiltwqrdgedqtqdvelvetrpagdgtfqkw
aavvvpsgeeqrytchvqhegeplmlrw

SCOPe Domain Coordinates for d2d31a1:

Click to download the PDB-style file with coordinates for d2d31a1.
(The format of our PDB-style files is described here.)

Timeline for d2d31a1: