Lineage for d2d07a_ (2d07 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101278Family c.18.1.2: Mug-like [52147] (3 protein domains)
  6. 2101279Protein G/T mismatch-specific thymine DNA glycosylase [159462] (1 species)
  7. 2101280Species Human (Homo sapiens) [TaxId:9606] [159463] (2 PDB entries)
    Uniprot Q13569 117-132
  8. 2101282Domain d2d07a_: 2d07 A: [145061]
    Other proteins in same PDB: d2d07b_
    automated match to d1wywa_

Details for d2d07a_

PDB Entry: 2d07 (more details), 2.1 Å

PDB Description: Crystal Structure of SUMO-3-modified Thymine-DNA Glycosylase
PDB Compounds: (A:) G/T mismatch-specific thymine DNA glycosylase

SCOPe Domain Sequences for d2d07a_:

Sequence, based on SEQRES records: (download)

>d2d07a_ c.18.1.2 (A:) G/T mismatch-specific thymine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsglsevq
lnhmddhtlpgkygigftnmverttpgskdlsskefreggrilvqklqkyqpriavfngk
ciyeifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyyikl
kdlrdqlkgiernmdvqevqytfdlqlaqedakkmavk

Sequence, based on observed residues (ATOM records): (download)

>d2d07a_ c.18.1.2 (A:) G/T mismatch-specific thymine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
gvseaelltktlpdiltfnldiviiginpglmaaykghhypgpgnhfwkclfmsglsevq
lnhmddhtlpgkygigftnmverttpglsskefreggrilvqklqkyqpriavfngkciy
eifskevfgvkvknlefglqphkipdtetlcyvmpsssarcaqfpraqdkvhyyiklkdl
rdqlkgiernmdvqevqytfdlqlaqedakkmavk

SCOPe Domain Coordinates for d2d07a_:

Click to download the PDB-style file with coordinates for d2d07a_.
(The format of our PDB-style files is described here.)

Timeline for d2d07a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2d07b_