Lineage for d2czvc1 (2czv C:3-120)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2563028Superfamily d.58.59: Rnp2-like [160350] (1 family) (S)
    contains extra C-terminal helix
    automatically mapped to Pfam PF01900
  5. 2563029Family d.58.59.1: Rpp14/Pop5-like [160351] (2 proteins)
    Pfam PF01900
  6. 2563030Protein RNase P protein component 2, Rnp2 [160352] (2 species)
  7. 2563037Species Pyrococcus horikoshii [TaxId:53953] [160353] (1 PDB entry)
    Uniprot O59150 3-120
  8. 2563038Domain d2czvc1: 2czv C:3-120 [145059]
    Other proteins in same PDB: d2czva_, d2czvb_
    protein/RNA complex; complexed with acy, bog

Details for d2czvc1

PDB Entry: 2czv (more details), 2 Å

PDB Description: crystal structure of archeal rnase p protein ph1481p in complex with ph1877p
PDB Compounds: (C:) Ribonuclease P protein component 2

SCOPe Domain Sequences for d2czvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czvc1 d.58.59.1 (C:3-120) RNase P protein component 2, Rnp2 {Pyrococcus horikoshii [TaxId: 53953]}
rklktlpptlrdknryiafeiisdgdftkdevkeliwksslevlgetgtaivkpwlikfd
pntktgivrsdreyveylrfalmlvsefngkrliirtlgvsgtikrlkrkflakygwk

SCOPe Domain Coordinates for d2czvc1:

Click to download the PDB-style file with coordinates for d2czvc1.
(The format of our PDB-style files is described here.)

Timeline for d2czvc1: