Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (21 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143537] (1 PDB entry) Uniprot O59494 140-301 |
Domain d2czcd2: 2czc D:140-301 [145058] Other proteins in same PDB: d2czca2, d2czcb1, d2czcc1, d2czcd1 automated match to d2czca1 complexed with nad, po4 |
PDB Entry: 2czc (more details), 2 Å
SCOPe Domain Sequences for d2czcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czcd2 d.81.1.1 (D:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Pyrococcus horikoshii [TaxId: 53953]} scnttglvrtlsaireyadyvyavmirraadpndtkrgpinaikptvevpshhgpdvqtv ipinietmafvvpttlmhvhsvmvelkkpltkddvidifenttrvllfekekgfdstaqi iefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd
Timeline for d2czcd2: