Lineage for d2czcd1 (2czc D:2-139,D:302-333)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828969Species Pyrococcus horikoshii [TaxId:53953] [159423] (1 PDB entry)
    Uniprot O59494 1-139,302-334
  8. 1828973Domain d2czcd1: 2czc D:2-139,D:302-333 [145057]
    Other proteins in same PDB: d2czca1, d2czcb2, d2czcc2, d2czcd2
    automated match to d2czca2
    complexed with nad, po4

Details for d2czcd1

PDB Entry: 2czc (more details), 2 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (D:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2czcd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czcd1 c.2.1.3 (D:2-139,D:302-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Pyrococcus horikoshii [TaxId: 53953]}
kvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefipr
fekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsf
vaqanyeaalgknyvrvvXvipenidairamfeladkwdsikktnkslgil

SCOPe Domain Coordinates for d2czcd1:

Click to download the PDB-style file with coordinates for d2czcd1.
(The format of our PDB-style files is described here.)

Timeline for d2czcd1: