Lineage for d2czcc2 (2czc C:140-301)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 866361Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 866362Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 866363Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 866417Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 866433Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143537] (1 PDB entry)
    Uniprot O59494 140-301
  8. 866436Domain d2czcc2: 2czc C:140-301 [145056]
    Other proteins in same PDB: d2czca2, d2czcb1, d2czcc1, d2czcd1
    automatically matched to 2CZC A:140-301
    complexed with nad, po4

Details for d2czcc2

PDB Entry: 2czc (more details), 2 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d2czcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2czcc2 d.81.1.1 (C:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
scnttglvrtlsaireyadyvyavmirraadpndtkrgpinaikptvevpshhgpdvqtv
ipinietmafvvpttlmhvhsvmvelkkpltkddvidifenttrvllfekekgfdstaqi
iefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd

SCOP Domain Coordinates for d2czcc2:

Click to download the PDB-style file with coordinates for d2czcc2.
(The format of our PDB-style files is described here.)

Timeline for d2czcc2: