Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [159423] (1 PDB entry) Uniprot O59494 1-139,302-334 |
Domain d2czcc1: 2czc C:2-139,C:302-334 [145055] Other proteins in same PDB: d2czca1, d2czcb2, d2czcc2, d2czcd2 automatically matched to 2CZC A:1-139,A:302-334 complexed with nad, po4 |
PDB Entry: 2czc (more details), 2 Å
SCOP Domain Sequences for d2czcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2czcc1 c.2.1.3 (C:2-139,C:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} kvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefipr fekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevsf vaqanyeaalgknyvrvvXvipenidairamfeladkwdsikktnkslgilk
Timeline for d2czcc1: