SCOPe 2.05: Domain d2czcb2: 2czc B:140-301

Lineage for d2czcb2 (2czc B:140-301)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143537] (1 PDB entry)
   Uniprot O59494 140-301

8. Domain d2czcb2: 2czc B:140-301 [145054]
   Other proteins in same PDB: d2czca2, d2czcb1, d2czcc1, d2czcd1
   automated match to d2czca1
   complexed with nad, po4

Details for d2czcb2

PDB Entry: 2czc, 2 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2czcb2:

Sequence; same for both SEQRES and ATOM records:

>d2czcb2 d.81.1.1 (B:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Pyrococcus horikoshii [TaxId: 53953]}
scnttglvrtlsaireyadyvyavmirraadpndtkrgpinaikptvevpshhgpdvqtv
ipinietmafvvpttlmhvhsvmvelkkpltkddvidifenttrvllfekekgfdstaqi
iefardlhrewnnlyeiavwkesinikgnrlfyiqavhqesd

Timeline for d2czcb2:

• d2czcb2 first appeared in SCOP 1.75
  
• d2czcb2 appears in SCOPe 2.04
  
• d2czcb2 appears in SCOPe 2.06
  
• d2czcb2 appears in the current release, SCOPe 2.08