SCOPe 2.02: Domain d2czca2: 2czc A:1-139,A:302-334

Lineage for d2czca2 (2czc A:1-139,A:302-334)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [159423] (1 PDB entry)
   Uniprot O59494 1-139,302-334

8. Domain d2czca2: 2czc A:1-139,A:302-334 [145052]
   Other proteins in same PDB: d2czca1, d2czcb2, d2czcc2, d2czcd2
   complexed with nad, po4

Details for d2czca2

PDB Entry: 2czc, 2 Å

PDB Description: Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Pyrococcus horikoshii OT3

PDB Compounds: (A:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2czca2:

Sequence; same for both SEQRES and ATOM records:

>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Pyrococcus horikoshii [TaxId: 53953]}
mkvkvgvngygtigkrvayavtkqddmeligitktkpdfeayrakelgipvyaaseefip
rfekegfevagtlndllekvdiivdatpggigaknkplyekagvkaifqggekadvaevs
fvaqanyeaalgknyvrvvXvipenidairamfeladkwdsikktnkslgilk

Timeline for d2czca2:

• d2czca2 first appeared in SCOP 1.75
  
• d2czca2 appears in SCOPe 2.01
  
• d2czca2 appears in SCOPe 2.03
  
• d2czca2 appears in the current release, SCOPe 2.08