| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily) 4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets |
Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) ![]() duplication: contains two structural repeats |
| Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins) automatically mapped to Pfam PF02979 |
| Protein Iron-containing nitrile hydratase [56211] (1 species) |
| Species Rhodococcus erythropolis [TaxId:1833] [56212] (3 PDB entries) also Rhodococcus sp. R312 |
| Domain d2cz0a1: 2cz0 A:9-205 [145051] Other proteins in same PDB: d2cz0b_ complexed with bua, fe |
PDB Entry: 2cz0 (more details), 1.5 Å
SCOPe Domain Sequences for d2cz0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cz0a1 d.149.1.1 (A:9-205) Iron-containing nitrile hydratase {Rhodococcus erythropolis [TaxId: 1833]}
enaapaqapvsdrawalfraldgkglvpdgyvegwkktfeedfsprrgaelvarawtdpe
frqllltdgtaavaqygylgpqgeyivavedtptlknvivcslcsctawpilglpptwyk
sfeyrarvvreprkvlsemgteiasdieirvydttaetrymvlpqrpagtegwsqeqlqe
ivtkdcligvaipqvpt
Timeline for d2cz0a1: