Class b: All beta proteins [48724] (174 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
Protein Periplasmic chaperone SafB [158947] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [158948] (2 PDB entries) Uniprot Q8ZRK3 152-236 |
Domain d2co7b2: 2co7 B:136-220 [145050] Other proteins in same PDB: d2co7a1, d2co7b1 automatically matched to 2CO6 B:136-220 complexed with so4 |
PDB Entry: 2co7 (more details), 1.8 Å
SCOPe Domain Sequences for d2co7b2:
Sequence, based on SEQRES records: (download)
>d2co7b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]} kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnmpg sahgdiewrvitdfggeshpfhyvl
>d2co7b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]} kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnhgd iewrvitdfggeshpfhyvl
Timeline for d2co7b2: