SCOP 1.75: Domain d2co7b2: 2co7 B:136-220

Lineage for d2co7b2 (2co7 B:136-220)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family)

5. Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)

6. Protein Periplasmic chaperone SafB [158947] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [158948] (2 PDB entries)
   Uniprot Q8ZRK3 152-236

8. Domain d2co7b2: 2co7 B:136-220 [145050]
   Other proteins in same PDB: d2co7a1, d2co7b1
   automatically matched to 2CO6 B:136-220
   complexed with so4; mutant

Details for d2co7b2

PDB Entry: 2co7, 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type ii)

PDB Compounds: (B:) putative fimbriae assembly chaperone

SCOP Domain Sequences for d2co7b2:

Sequence, based on SEQRES records:

>d2co7b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnmpg
sahgdiewrvitdfggeshpfhyvl

Sequence, based on observed residues (ATOM records):

>d2co7b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnhgd
iewrvitdfggeshpfhyvl

Timeline for d2co7b2:

• d2co7b2 is new in SCOP 1.75
  
• d2co7b2 appears in SCOPe 2.01
  
• d2co7b2 appears in the current release, SCOPe 2.08