Lineage for d2co7b1 (2co7 B:8-135)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937239Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 937240Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 937281Protein Periplasmic chaperone SafB [158907] (1 species)
  7. 937282Species Salmonella typhimurium [TaxId:90371] [158908] (2 PDB entries)
    Uniprot Q8ZRK3 21-151
  8. 937283Domain d2co7b1: 2co7 B:8-135 [145049]
    Other proteins in same PDB: d2co7a1, d2co7b2
    automatically matched to 2CO6 B:5-135
    complexed with so4

Details for d2co7b1

PDB Entry: 2co7 (more details), 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type ii)
PDB Compounds: (B:) putative fimbriae assembly chaperone

SCOPe Domain Sequences for d2co7b1:

Sequence, based on SEQRES records: (download)

>d2co7b1 b.1.11.1 (B:8-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
atklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpplfr
leanqqsqlrivrtggdmptdretlqwvcikavppenepsdtqakgatldlnlsinacdk
lifrpdav

Sequence, based on observed residues (ATOM records): (download)

>d2co7b1 b.1.11.1 (B:8-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
atklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpplfr
leanqqsqlrivrtggdmptdretlqwvcikavppetldlnlsinacdklifrpdav

SCOPe Domain Coordinates for d2co7b1:

Click to download the PDB-style file with coordinates for d2co7b1.
(The format of our PDB-style files is described here.)

Timeline for d2co7b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2co7b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2co7a1