SCOP 1.75: Domain d2co7b1: 2co7 B:8-135

Lineage for d2co7b1 (2co7 B:8-135)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.1: Pilus chaperone [49355] (5 proteins)

6. Protein Periplasmic chaperone SafB [158907] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [158908] (2 PDB entries)
   Uniprot Q8ZRK3 21-151

8. Domain d2co7b1: 2co7 B:8-135 [145049]
   Other proteins in same PDB: d2co7a1, d2co7b2
   automatically matched to 2CO6 B:5-135
   complexed with so4; mutant

Details for d2co7b1

PDB Entry: 2co7, 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type ii)

PDB Compounds: (B:) putative fimbriae assembly chaperone

SCOP Domain Sequences for d2co7b1:

Sequence, based on SEQRES records:

>d2co7b1 b.1.11.1 (B:8-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
atklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpplfr
leanqqsqlrivrtggdmptdretlqwvcikavppenepsdtqakgatldlnlsinacdk
lifrpdav

Sequence, based on observed residues (ATOM records):

>d2co7b1 b.1.11.1 (B:8-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
atklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpplfr
leanqqsqlrivrtggdmptdretlqwvcikavppetldlnlsinacdklifrpdav

Timeline for d2co7b1:

• d2co7b1 is new in SCOP 1.75
  
• d2co7b1 appears in SCOPe 2.01
  
• d2co7b1 appears in the current release, SCOPe 2.08