Lineage for d2co6b2 (2co6 B:136-220)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1304037Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1304224Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 1304225Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 1304298Protein Periplasmic chaperone SafB [158947] (1 species)
  7. 1304299Species Salmonella typhimurium [TaxId:90371] [158948] (2 PDB entries)
    Uniprot Q8ZRK3 152-236
  8. 1304301Domain d2co6b2: 2co6 B:136-220 [145048]
    Other proteins in same PDB: d2co6a_, d2co6b1

Details for d2co6b2

PDB Entry: 2co6 (more details), 2 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type i)
PDB Compounds: (B:) putative fimbriae assembly chaperone

SCOPe Domain Sequences for d2co6b2:

Sequence, based on SEQRES records: (download)

>d2co6b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnmpg
sahgdiewrvitdfggeshpfhyvl

Sequence, based on observed residues (ATOM records): (download)

>d2co6b2 b.7.2.1 (B:136-220) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
kgtpedvagnlrwvetgnklkvenptpfymnlasvtvggkpitgleyvppfadktlnmpg
shgdiewrvitdfggeshpfhyvl

SCOPe Domain Coordinates for d2co6b2:

Click to download the PDB-style file with coordinates for d2co6b2.
(The format of our PDB-style files is described here.)

Timeline for d2co6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2co6b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2co6a_