Lineage for d2co6b1 (2co6 B:5-135)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1111327Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 1111328Family b.1.11.1: Pilus chaperone [49355] (5 proteins)
  6. 1111369Protein Periplasmic chaperone SafB [158907] (1 species)
  7. 1111370Species Salmonella typhimurium [TaxId:90371] [158908] (2 PDB entries)
    Uniprot Q8ZRK3 21-151
  8. 1111372Domain d2co6b1: 2co6 B:5-135 [145047]
    Other proteins in same PDB: d2co6a_, d2co6b2

Details for d2co6b1

PDB Entry: 2co6 (more details), 2 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type i)
PDB Compounds: (B:) putative fimbriae assembly chaperone

SCOPe Domain Sequences for d2co6b1:

Sequence, based on SEQRES records: (download)

>d2co6b1 b.1.11.1 (B:5-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
lnsatklfsvklgatrviyhagtagatlsvsnpqnypilvqssvkaadksspapflvmpp
lfrleanqqsqlrivrtggdmptdretlqwvcikavppenepsdtqakgatldlnlsina
cdklifrpdav

Sequence, based on observed residues (ATOM records): (download)

>d2co6b1 b.1.11.1 (B:5-135) Periplasmic chaperone SafB {Salmonella typhimurium [TaxId: 90371]}
lnsatklfsvklgatrviyhagtgatlsvsnpqnypilvqssvkaadksspapflvmppl
frleanqqsqlrivrtggdmptdretlqwvcikavppenepgatldlnlsinacdklifr
pdav

SCOPe Domain Coordinates for d2co6b1:

Click to download the PDB-style file with coordinates for d2co6b1.
(The format of our PDB-style files is described here.)

Timeline for d2co6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2co6b2
View in 3D
Domains from other chains:
(mouse over for more information)
d2co6a_