Lineage for d2ck3c1 (2ck3 C:380-510)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739159Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1739160Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families) (S)
  5. 1739161Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 1739162Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 1739165Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 1739171Domain d2ck3c1: 2ck3 C:380-510 [145039]
    Other proteins in same PDB: d2ck3a2, d2ck3a3, d2ck3b2, d2ck3b3, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_
    automated match to d1e79a1
    complexed with adp, anp, azi, mg, po4

Details for d2ck3c1

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (C:) ATP synthase subunit alpha, mitochondrial

SCOPe Domain Sequences for d2ck3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3c1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d2ck3c1:

Click to download the PDB-style file with coordinates for d2ck3c1.
(The format of our PDB-style files is described here.)

Timeline for d2ck3c1: