Class a: All alpha proteins [46456] (284 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries) Uniprot P19483 |
Domain d2ck3c1: 2ck3 C:380-510 [145039] Other proteins in same PDB: d2ck3a2, d2ck3a3, d2ck3b2, d2ck3b3, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g_, d2ck3h1, d2ck3h2, d2ck3i_ automatically matched to d1bmfa1 complexed with adp, anp, azi, mg, po4 |
PDB Entry: 2ck3 (more details), 1.9 Å
SCOPe Domain Sequences for d2ck3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ck3c1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d2ck3c1: