Lineage for d2ck3a1 (2ck3 A:380-510)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771914Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 771915Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 771916Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 771917Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 771920Species Cow (Bos taurus) [TaxId:9913] [88893] (14 PDB entries)
    Uniprot P19483
  8. 771924Domain d2ck3a1: 2ck3 A:380-510 [145033]
    Other proteins in same PDB: d2ck3a2, d2ck3a3, d2ck3b2, d2ck3b3, d2ck3c2, d2ck3c3, d2ck3d1, d2ck3d2, d2ck3d3, d2ck3e1, d2ck3e2, d2ck3e3, d2ck3f1, d2ck3f2, d2ck3f3, d2ck3g1, d2ck3h1, d2ck3h2
    automatically matched to d1bmfa1
    complexed with adp, anp, azi, mg, po4

Details for d2ck3a1

PDB Entry: 2ck3 (more details), 1.9 Å

PDB Description: Azide inhibited bovine F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain heart isoform

SCOP Domain Sequences for d2ck3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck3a1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d2ck3a1:

Click to download the PDB-style file with coordinates for d2ck3a1.
(The format of our PDB-style files is described here.)

Timeline for d2ck3a1: