Lineage for d2cdee1 (2cde E:2-115)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 protein domains)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786832Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries)
  8. 786855Domain d2cdee1: 2cde E:2-115 [145031]
    Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
    automatically matched to 2CDE A:2-115

Details for d2cdee1

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (E:) inkt-tcr

SCOP Domain Sequences for d2cdee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdee1 b.1.1.2 (E:2-115) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

SCOP Domain Coordinates for d2cdee1:

Click to download the PDB-style file with coordinates for d2cdee1.
(The format of our PDB-style files is described here.)

Timeline for d2cdee1: