![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (7 species) |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries) |
![]() | Domain d2cdec2: 2cde C:116-193 [145030] Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1 automatically matched to 2CDE A:116-193 |
PDB Entry: 2cde (more details), 3.5 Å
SCOPe Domain Sequences for d2cdec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdec2 b.1.1.2 (C:116-193) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns avawsnksdfacanafnn
Timeline for d2cdec2: