SCOPe 2.08: Domain d2cdea2: 2cde A:116-193

Lineage for d2cdea2 (2cde A:116-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)

8. Domain d2cdea2: 2cde A:116-193 [145028]
   Other proteins in same PDB: d2cdea1, d2cdeb1, d2cded1, d2cdef1
   missing some secondary structures that made up less than one-third of the common domain

Details for d2cdea2

PDB Entry: 2cde, 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr

PDB Compounds: (A:) inkt-tcr

SCOPe Domain Sequences for d2cdea2:

Sequence; same for both SEQRES and ATOM records:

>d2cdea2 b.1.1.2 (A:116-193) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnn

Timeline for d2cdea2:

• d2cdea2 first appeared in SCOP 1.75
  
• d2cdea2 appears in SCOPe 2.07