Lineage for d2cdea1 (2cde A:2-115)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289783Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries)
  8. 1289822Domain d2cdea1: 2cde A:2-115 [145027]
    Other proteins in same PDB: d2cdea2, d2cdeb2, d2cdec1, d2cdec2, d2cded2, d2cdee1, d2cdee2, d2cdef2

Details for d2cdea1

PDB Entry: 2cde (more details), 3.5 Å

PDB Description: structure and binding kinetics of three different human cd1d-alpha-galactosylceramide specific t cell receptors -inkt-tcr
PDB Compounds: (A:) inkt-tcr

SCOPe Domain Sequences for d2cdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nqveqspqsliilegknctlqcnytvspfsnlrwykqdtgrgpvsltimtfsentksngr
ytatldadtkqsslhitasqlsdsasyicvvsdrgstlgrlyfgrgtqltvwpd

SCOPe Domain Coordinates for d2cdea1:

Click to download the PDB-style file with coordinates for d2cdea1.
(The format of our PDB-style files is described here.)

Timeline for d2cdea1: