SCOPe 2.08: Domain d2c9wa2: 2c9w A:32-134

Lineage for d2c9wa2 (2c9w A:32-134)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [160563] (2 PDB entries)
   Uniprot O14508 32-134

8. Domain d2c9wa2: 2c9w A:32-134 [145024]
   Other proteins in same PDB: d2c9wa1, d2c9wb_, d2c9wc_
   complexed with ni, so4

Details for d2c9wa2

PDB Entry: 2c9w, 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution

PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d2c9wa2:

Sequence; same for both SEQRES and ATOM records:

>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

Timeline for d2c9wa2:

• d2c9wa2 first appeared in SCOP 1.75
  
• d2c9wa2 appears in SCOPe 2.07