Lineage for d2c9wa1 (2c9w A:149-198)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1287031Fold a.271: SOCS box-like [158234] (1 superfamily)
    helix-loop-helix motif with orthogonally packed helices
  4. 1287032Superfamily a.271.1: SOCS box-like [158235] (1 family) (S)
  5. 1287033Family a.271.1.1: SOCS box-like [158236] (2 proteins)
    Pfam PF07525
  6. 1287034Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species)
  7. 1287035Species Human (Homo sapiens) [TaxId:9606] [158240] (1 PDB entry)
    Uniprot O14508 149-198
  8. 1287036Domain d2c9wa1: 2c9w A:149-198 [145023]
    Other proteins in same PDB: d2c9wa2, d2c9wb_, d2c9wc_
    complexed with ni, so4

Details for d2c9wa1

PDB Entry: 2c9w (more details), 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d2c9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c9wa1 a.271.1.1 (A:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

SCOPe Domain Coordinates for d2c9wa1:

Click to download the PDB-style file with coordinates for d2c9wa1.
(The format of our PDB-style files is described here.)

Timeline for d2c9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c9wa2