![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.271: SOCS box-like [158234] (1 superfamily) helix-loop-helix motif with orthogonally packed helices |
![]() | Superfamily a.271.1: SOCS box-like [158235] (2 families) ![]() |
![]() | Family a.271.1.1: SOCS box-like [158236] (2 proteins) Pfam PF07525 |
![]() | Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158240] (2 PDB entries) Uniprot O14508 149-198 |
![]() | Domain d2c9wa1: 2c9w A:149-198 [145023] Other proteins in same PDB: d2c9wa2, d2c9wb_, d2c9wc_ complexed with ni, so4 |
PDB Entry: 2c9w (more details), 1.9 Å
SCOPe Domain Sequences for d2c9wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c9wa1 a.271.1.1 (A:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv
Timeline for d2c9wa1: