SCOPe 2.08: Domain d2c9wa1: 2c9w A:149-198

Lineage for d2c9wa1 (2c9w A:149-198)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.271: SOCS box-like [158234] (1 superfamily)
   helix-loop-helix motif with orthogonally packed helices

4. Superfamily a.271.1: SOCS box-like [158235] (2 families)

5. Family a.271.1.1: SOCS box-like [158236] (2 proteins)
   Pfam PF07525

6. Protein Suppressor of cytokine signaling 2, SOCS-2 [158239] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158240] (2 PDB entries)
   Uniprot O14508 149-198

8. Domain d2c9wa1: 2c9w A:149-198 [145023]
   Other proteins in same PDB: d2c9wa2, d2c9wb_, d2c9wc_
   complexed with ni, so4

Details for d2c9wa1

PDB Entry: 2c9w, 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution

PDB Compounds: (A:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d2c9wa1:

Sequence; same for both SEQRES and ATOM records:

>d2c9wa1 a.271.1.1 (A:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
hlyltkplytsapslqhlcrltinkctgaiwglplptrlkdyleeykfqv

Timeline for d2c9wa1:

• d2c9wa1 first appeared in SCOP 1.75
  
• d2c9wa1 appears in SCOPe 2.07