Lineage for d2c52b1 (2c52 B:303-353)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779224Fold a.153: Nuclear receptor coactivator interlocking domain [69124] (1 superfamily)
    3 helices, non-globular array; forms interlocked heterodimers with its targets
  4. 779225Superfamily a.153.1: Nuclear receptor coactivator interlocking domain [69125] (1 family) (S)
    not a true superfamily
  5. 779226Family a.153.1.1: Nuclear receptor coactivator interlocking domain [69126] (3 proteins)
  6. 779227Protein Nuclear receptor coactivator 1, NCOA1 [158848] (1 species)
  7. 779228Species Human (Homo sapiens) [TaxId:9606] [158849] (1 PDB entry)
    Uniprot Q4PJW2 920-970
  8. 779229Domain d2c52b1: 2c52 B:303-353 [145022]
    Other proteins in same PDB: d2c52a1

Details for d2c52b1

PDB Entry: 2c52 (more details)

PDB Description: structural diversity in cbp p160 complexes
PDB Compounds: (B:) Nuclear receptor coactivator 1

SCOP Domain Sequences for d2c52b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c52b1 a.153.1.1 (B:303-353) Nuclear receptor coactivator 1, NCOA1 {Human (Homo sapiens) [TaxId: 9606]}
pttvegrndekalleqlvsflsgkdetelaeldralgidklvqgggldvls

SCOP Domain Coordinates for d2c52b1:

Click to download the PDB-style file with coordinates for d2c52b1.
(The format of our PDB-style files is described here.)

Timeline for d2c52b1: