Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (12 PDB entries) Uniprot P13726 33-242 |
Domain d2c4fu1: 2c4f U:91-210 [145021] Other proteins in same PDB: d2c4fh1, d2c4fl1, d2c4fl2, d2c4fl3 complexed with ca, fuc, gil, glc, nag |
PDB Entry: 2c4f (more details), 1.72 Å
SCOP Domain Sequences for d2c4fu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} eplyenspeftpyletnlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkd liytlyywsgkktaktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Timeline for d2c4fu1:
View in 3D Domains from other chains: (mouse over for more information) d2c4fh1, d2c4fl1, d2c4fl2, d2c4fl3 |