![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein automated matches [190232] (2 species) not a true protein |
![]() | Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries) |
![]() | Domain d2buya_: 2buy A: [145018] Other proteins in same PDB: d2buyb_ automated match to d2buxa1 complexed with caq, fe; mutant |
PDB Entry: 2buy (more details), 1.8 Å
SCOPe Domain Sequences for d2buya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buya_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]} elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk gstqaphisliifahginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd gevvyrfdiriqgenetvffdi
Timeline for d2buya_: