Lineage for d2buya_ (2buy A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2769889Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2769890Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 2770292Protein automated matches [190232] (2 species)
    not a true protein
  7. 2770293Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 2770303Domain d2buya_: 2buy A: [145018]
    Other proteins in same PDB: d2buyb_
    automated match to d2buxa1
    complexed with caq, fe; mutant

Details for d2buya_

PDB Entry: 2buy (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h in complex with catechol
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buya_ b.3.6.1 (A:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifahginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

SCOPe Domain Coordinates for d2buya_:

Click to download the PDB-style file with coordinates for d2buya_.
(The format of our PDB-style files is described here.)

Timeline for d2buya_: