SCOPe 2.05: Domain d2buxa1: 2bux A:4-200

Lineage for d2buxa1 (2bux A:4-200)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
   alpha and beta chains are derived from a single-chain protomer and share this fold

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49488] (6 PDB entries)

8. Domain d2buxa1: 2bux A:4-200 [145017]
   Other proteins in same PDB: d2buxb_
   complexed with fe, oh; mutant

Details for d2buxa1

PDB Entry: 2bux, 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h

PDB Compounds: (A:) protocatechuate 3,4-dioxygenase alpha chain

SCOPe Domain Sequences for d2buxa1:

Sequence; same for both SEQRES and ATOM records:

>d2buxa1 b.3.6.1 (A:4-200) Protocatechuate-3,4-dioxygenase, alpha chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
elketpsqtggpyvhigllpkqanievfehnldnnlvqdntqgqrirlegqvfdglglpl
rdvlieiwqadtngvypsqadtqgkqvdpnflgwgrtgadfgtgfwsfntikpgavpgrk
gstqaphisliifahginiglhtrvyfddeaeanakdpvlnsiewatrrqtlvakreerd
gevvyrfdiriqgenetvffdi

Timeline for d2buxa1:

• d2buxa1 first appeared in SCOP 1.75
  
• d2buxa1 appears in SCOPe 2.04
  
• d2buxa1 appears in SCOPe 2.06
  
• d2buxa1 appears in the current release, SCOPe 2.08