SCOPe 2.01: Domain d2buwb_: 2buw B:

Lineage for d2buwb_ (2buw B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein automated matches [190232] (2 species)
   not a true protein

7. Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)

8. Domain d2buwb_: 2buw B: [145016]
   automated match to d1eo2b_
   complexed with fe, phb; mutant

Details for d2buwb_

PDB Entry: 2buw, 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with 4-hydroxybenzoate

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2buwb_:

Sequence; same for both SEQRES and ATOM records:

>d2buwb_ b.3.6.1 (B:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d2buwb_:

• d2buwb_ first appeared in SCOP 1.75, called d2buwb1
  
• d2buwb_ appears in SCOPe 2.02
  
• d2buwb_ appears in the current release, SCOPe 2.08