Lineage for d2buvb_ (2buv B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1774044Protein automated matches [190232] (2 species)
    not a true protein
  7. 1774045Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 1774054Domain d2buvb_: 2buv B: [145015]
    automated match to d1eo2b_
    complexed with dhb, fe; mutant

Details for d2buvb_

PDB Entry: 2buv (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with protocatechuate
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2buvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buvb_ b.3.6.1 (B:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOPe Domain Coordinates for d2buvb_:

Click to download the PDB-style file with coordinates for d2buvb_.
(The format of our PDB-style files is described here.)

Timeline for d2buvb_: