Lineage for d2buub_ (2buu B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2364769Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2365897Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 2365898Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 protein domains)
    sandwich; 9 strands in 2 sheets
  6. 2366300Protein automated matches [190232] (2 species)
    not a true protein
  7. 2366301Species Acinetobacter calcoaceticus [TaxId:62977] [186997] (9 PDB entries)
  8. 2366307Domain d2buub_: 2buu B: [145014]
    automated match to d1eo2b_
    complexed with 4nc, fe; mutant

Details for d2buub_

PDB Entry: 2buu (more details), 1.8 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s in complex with 4-nitrocatechol
PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2buub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buub_ b.3.6.1 (B:) automated matches {Acinetobacter calcoaceticus [TaxId: 62977]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

SCOPe Domain Coordinates for d2buub_:

Click to download the PDB-style file with coordinates for d2buub_.
(The format of our PDB-style files is described here.)

Timeline for d2buub_: