SCOPe 2.05: Domain d2butb1: 2but B:303-540

Lineage for d2butb1 (2but B:303-540)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)

8. Domain d2butb1: 2but B:303-540 [145013]
   Other proteins in same PDB: d2buta_
   complexed with fe, oh; mutant

Details for d2butb1

PDB Entry: 2but, 1.85 Å

PDB Description: crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r457s - apo

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d2butb1:

Sequence; same for both SEQRES and ATOM records:

>d2butb1 b.3.6.1 (B:303-540) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewspahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d2butb1:

• d2butb1 first appeared in SCOP 1.75
  
• d2butb1 appears in SCOPe 2.04
  
• d2butb1 appears in SCOPe 2.06
  
• d2butb1 appears in the current release, SCOPe 2.08