Lineage for d2btob1 (2bto B:3-246)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828655Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 828656Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) (S)
  5. 828657Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)
  6. 828696Protein Tubulin alpha-subunit [52494] (3 species)
  7. 828709Species Prosthecobacter dejongeii [TaxId:48465] [159531] (2 PDB entries)
    Uniprot Q8GCC5 3-246
    bacterial tubulin BtubA
  8. 828711Domain d2btob1: 2bto B:3-246 [145011]
    Other proteins in same PDB: d2btoa2, d2btob2, d2btot1
    automatically matched to 2BTO A:3-246
    complexed with gtp

Details for d2btob1

PDB Entry: 2bto (more details), 2.5 Å

PDB Description: structure of btuba from prosthecobacter dejongeii
PDB Compounds: (B:) tubulin btuba

SCOP Domain Sequences for d2btob1:

Sequence, based on SEQRES records: (download)

>d2btob1 c.32.1.1 (B:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
vnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgesssg
syvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpevms
rldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspqvssv
vtepyntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagita
smrf

Sequence, based on observed residues (ATOM records): (download)

>d2btob1 c.32.1.1 (B:3-246) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
vnntivvsigqagnqiaasfwktvclehgidpltgqtapgvaprgnwssffsklgesssg
syvpraimvdlepsvidnvkatsgslfnpanlisrtegaggnfavgylgagrevlpevms
rldyeidkcdnvggiivlhaigggtgsgfgallieslkekygeipvlscavlpspvtepy
ntvfalntlrrsadaclifdnealfdlahrkwniesptvddlnllitealagitasmrf

SCOP Domain Coordinates for d2btob1:

Click to download the PDB-style file with coordinates for d2btob1.
(The format of our PDB-style files is described here.)

Timeline for d2btob1: