Lineage for d2btoa2 (2bto A:253-432)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959167Protein Tubulin alpha-subunit [55311] (3 species)
  7. 2959181Species Prosthecobacter dejongeii [TaxId:48465] [160500] (2 PDB entries)
    Uniprot Q8GCC5 253-432
    bacterial tubulin BtubA
  8. 2959182Domain d2btoa2: 2bto A:253-432 [145010]
    Other proteins in same PDB: d2btoa1, d2btob1, d2btot_
    complexed with gtp

Details for d2btoa2

PDB Entry: 2bto (more details), 2.5 Å

PDB Description: structure of btuba from prosthecobacter dejongeii
PDB Compounds: (A:) tubulin btuba

SCOPe Domain Sequences for d2btoa2:

Sequence, based on SEQRES records: (download)

>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslfdngsvfaacspm
egrflstavlyrgimedkpladaalaamreklpltywiptafkigyveqpgishrksmvl
lannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee

Sequence, based on observed residues (ATOM records): (download)

>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdelgieemikslfdngsvfaacspmegrfl
stavlyrgipladaalaamreklpltywiptafkigyveqpgishrksmvllannteiar
vldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee

SCOPe Domain Coordinates for d2btoa2:

Click to download the PDB-style file with coordinates for d2btoa2.
(The format of our PDB-style files is described here.)

Timeline for d2btoa2: