SCOPe 2.08: Domain d2btoa2: 2bto A:253-432

Lineage for d2btoa2 (2bto A:253-432)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Tubulin alpha-subunit [55311] (3 species)

7. Species Prosthecobacter dejongeii [TaxId:48465] [160500] (2 PDB entries)
   Uniprot Q8GCC5 253-432
   bacterial tubulin BtubA

8. Domain d2btoa2: 2bto A:253-432 [145010]
   Other proteins in same PDB: d2btoa1, d2btob1, d2btot_
   complexed with gtp

Details for d2btoa2

PDB Entry: 2bto, 2.5 Å

PDB Description: structure of btuba from prosthecobacter dejongeii

PDB Compounds: (A:) tubulin btuba

SCOPe Domain Sequences for d2btoa2:

Sequence, based on SEQRES records:

>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdrskfeelgieemikslfdngsvfaacspm
egrflstavlyrgimedkpladaalaamreklpltywiptafkigyveqpgishrksmvl
lannteiarvldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee

Sequence, based on observed residues (ATOM records):

>d2btoa2 d.79.2.1 (A:253-432) Tubulin alpha-subunit {Prosthecobacter dejongeii [TaxId: 48465]}
eislrelltnlvpqpslhflmcafapltppdelgieemikslfdngsvfaacspmegrfl
stavlyrgipladaalaamreklpltywiptafkigyveqpgishrksmvllannteiar
vldrichnfdklwqrkafanwylnegmseeqinvlrasaqelvqsyqvaee

Timeline for d2btoa2:

• d2btoa2 first appeared in SCOP 1.75
  
• d2btoa2 appears in SCOPe 2.07