Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
Protein automated matches [190227] (1 species) not a true protein |
Species Wolinella succinogenes [TaxId:844] [186991] (3 PDB entries) |
Domain d2bs4f_: 2bs4 F: [145008] Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4c1, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4e2 automated match to d2bs4c1 complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs4 (more details), 2.76 Å
SCOPe Domain Sequences for d2bs4f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs4f_ f.21.2.1 (F:) automated matches {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavi lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrthh
Timeline for d2bs4f_: