Lineage for d2bs4c1 (2bs4 C:1-255)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629948Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2630045Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2630046Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 2630047Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 2630048Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries)
  8. 2630054Domain d2bs4c1: 2bs4 C:1-255 [145007]
    Other proteins in same PDB: d2bs4a1, d2bs4a2, d2bs4a3, d2bs4b1, d2bs4b2, d2bs4d1, d2bs4d2, d2bs4d3, d2bs4e1, d2bs4e2, d2bs4f_
    complexed with cit, dmw, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs4c1

PDB Entry: 2bs4 (more details), 2.76 Å

PDB Description: glu c180 -> ile variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (C:) quinol-fumarate reductase diheme cytochrome b subunit c

SCOPe Domain Sequences for d2bs4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs4c1 f.21.2.1 (C:1-255) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavi
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrthh

SCOPe Domain Coordinates for d2bs4c1:

Click to download the PDB-style file with coordinates for d2bs4c1.
(The format of our PDB-style files is described here.)

Timeline for d2bs4c1: