![]() | Class f: Membrane and cell surface proteins and peptides [56835] (58 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (1 protein) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
![]() | Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species) |
![]() | Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries) |
![]() | Domain d2bs3f1: 2bs3 F:1-255 [145006] Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3e2 automatically matched to 2BS3 C:1-255 complexed with cit, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs3 (more details), 2.19 Å
SCOP Domain Sequences for d2bs3f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs3f1 f.21.2.1 (F:1-255) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrthh
Timeline for d2bs3f1: