![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins) duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry |
![]() | Protein automated matches [190227] (1 species) not a true protein |
![]() | Species Wolinella succinogenes [TaxId:844] [186991] (3 PDB entries) |
![]() | Domain d2bs3f_: 2bs3 F: [145006] Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3c1, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3e2 automated match to d2bs3c1 complexed with cit, f3s, fad, fes, hem, lmt, na, sf4 |
PDB Entry: 2bs3 (more details), 2.19 Å
SCOPe Domain Sequences for d2bs3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs3f_ f.21.2.1 (F:) automated matches {Wolinella succinogenes [TaxId: 844]} mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd pnidykyfdykrthh
Timeline for d2bs3f_: