Lineage for d2bs3c1 (2bs3 C:1-255)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253424Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2253425Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
    duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry
  6. 2253426Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)
  7. 2253427Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries)
  8. 2253428Domain d2bs3c1: 2bs3 C:1-255 [145005]
    Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b1, d2bs3b2, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e1, d2bs3e2, d2bs3f_
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs3c1

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (C:) quinol-fumarate reductase diheme cytochrome b subunit c

SCOPe Domain Sequences for d2bs3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3c1 f.21.2.1 (C:1-255) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfavq
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrthh

SCOPe Domain Coordinates for d2bs3c1:

Click to download the PDB-style file with coordinates for d2bs3c1.
(The format of our PDB-style files is described here.)

Timeline for d2bs3c1: